SmartViper

Mysql websites probably the best selection from 15,116 total domains

Visitors who searched Mysql also search php,  sql,  database

50webs.com Favicon 50webs.com - Free Web Hosting Affordable Shared Hosting and Domain Names by 50Webs

50Webs is a leading provider of free web hosting low-cost shared hosting and domain names. 500000 websites trust 50Webs for their hosting needs

Tagged as: web hosting, web, hosting. See more tags (30) at 50webs.com page.

http://www.50webs.com/

Elance.com Favicon Elance.com - Hire freelancers and find freelance jobs instantly Elance

Access over 2 million skilled freelancers from around the world. Find rated web developers mobile programmers designers writers translators marketing pros virtual assistants and more

Tagged as: seo, joomla, php. See more tags (28) at elance.com page.

http://elance.com/

Wz.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: web, hosting, php. See more tags (9) at wz.cz page.

http://www.webzdarma.cz/

Kamyabonline.com Favicon Kamyabonline.com

pdf

Tagged as: blog, software, games. See more tags (29) at kamyabonline.com page.

http://kamyabonline.com/

Phpbuilder.com Favicon Phpbuilder.com - PHP Developers Sharing Knowledge Since 1999 PHPBuilder.com

PHP Developers Sharing Knowledge Since 1999

Tagged as: e commerce, php, flash. See more tags (31) at phpbuilder.com page.

http://www.phpbuilder.com/

Heteml.jp Favicon Heteml.jp - WordPress

heteml200.71GB1500Flash Media Server

Tagged as: coldfusion, aplicacin, fms. See more tags (18) at heteml.jp page.

http://heteml.jp/

Ic.cz Favicon Ic.cz - IC.cz - webhosting zdarma freehosting PHP4 PHP5 MySql PostgreSql strnky zdarma blog fotogalerie

Free web host and web tool provider. Get a website guestbook counter etc. We support php php5 mysqlpostgresql technologies.!

Tagged as: a website, web, hosting. See more tags (27) at ic.cz page.

http://www.ic.cz/

Bplaced.net Favicon Bplaced.net - bplaced - Webspace & Webhosting 2GB Freehost The place for your webspace

Tagged as: hosting, php, webhosting. See more tags (12) at bplaced.net page.

http://www.bplaced.net/

Vn-zoom.com Favicon Vn-zoom.com - VN-Zoom - Chia s kin thc v phn mm my tnh

Softwares - Entertainment - Games

Tagged as: web hosting, video, php. See more tags (32) at vn-zoom.com page.

http://www.vn-zoom.com/

Atpages.jp Favicon Atpages.jp - @PAGES!!

PAGES 1GBPHPCGI

Tagged as: php, cgi, iletim. See more tags (10) at atpages.jp page.

http://atpages.jp/

Knowsky.com Favicon Knowsky.com - www.knowsky.com

jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop

Tagged as: php, linux, server. See more tags (25) at knowsky.com page.

http://knowsky.com/

Webadictos.com.mx Favicon Webadictos.com.mx - WebAdictos

Tagged as: internet, php, javascript. See more tags (19) at webadictos.com.mx page.

http://www.webadictos.com.mx/

Prv.pl Favicon Prv.pl - Darmowe domeny darmowy hosting www

Darmowe serwery www. Darmowe strony internetowe bez opat. Hosting Wordpress za darmo serwer PHP

Tagged as: hosting, www, pmu rsultat. See more tags (13) at prv.pl page.

http://www.prv.pl/

Siteduzero.com Favicon Siteduzero.com - OpenClassrooms ex-Le Site du Zro - Les cours les plus ouverts du Web

Tagged as: design, web, php. See more tags (28) at siteduzero.com page.

http://fr.openclassrooms.com/

Almshaheer.com Favicon Almshaheer.com

Tagged as: blog, games, game. See more tags (30) at almshaheer.com page.

http://almshaheer.com/

Webd.pl - Tani Profesjonalny Hosting WWW Serwery i Domeny od 399 PLN

Profesjonalne usugi hostingowe dla firm oraz uytkownikw indywidualnych. Serwery PHP MySQL. Rejestracja domen krajowych regionalnych oraz midzynarodowych

Tagged as: hosting, php, www. See more tags (24) at webd.pl page.

http://webd.pl/

Pytal.de Favicon Pytal.de - Pytal

Tagged as: php, community, gratis. See more tags (12) at pytal.de page.

http://www.pytal.de/

Tranungkite.net - TranungKite Online TKO

Berita Terkini Pelbagai Sumber

Tagged as: blog, forum, php. See more tags (35) at tranungkite.net page.

http://tranungkite.net/v12/

Zenon.net Favicon Zenon.net - " ..."

Tagged as: hosting, php, windows. See more tags (34) at zenon.net page.

http://www.zenon.net/

Howtogeek.com Favicon Howtogeek.com - How-To Geek - For Geeks By Geeks

Tagged as: windows, linux, networking. See more tags (27) at howtogeek.com page.

http://www.howtogeek.com/

Pspisoz.com Favicon Pspisoz.com - PSPISOz

Tagged as: blog, games, game. See more tags (32) at pspisoz.com page.

http://pspisoz.com/

Digitalz.org - Digitalz.org - ndice

Digitalz.org - ndice

Tagged as: forum, php, board. See more tags (12) at digitalz.org page.

http://www.digitalz.org/foro/

80code.com - 80code.com

4806GBOKMySQLSSL

Tagged as: php, net, cgi. See more tags (34) at 80code.com page.

http://80code.com/

Ntnu.edu.tw Favicon Ntnu.edu.tw

XOOPS is a dynamic Object Oriented based open source portal script written in PHP

Tagged as: php, cms, portal. See more tags (35) at ntnu.edu.tw page.

http://www2.ntnu.edu.tw/

Dreamhost.com Favicon Dreamhost.com - Web Hosting Domains VPS Dedicated and WordPress Hosting - DreamHost

DreamHost is the leader in shared web hosting vps hosting dedicated hosting WordPress hosting cloud storage and cloud computing. Try us for Free today

Tagged as: web hosting, php, ecommerce. See more tags (31) at dreamhost.com page.

http://www.dreamhost.com/

Arabdz.com Favicon Arabdz.com

Tagged as: blog, games, game. See more tags (34) at arabdz.com page.

http://arabdz.com/protal/index.php

World4you.com Favicon World4you.com - Webspace Webhosting Domain World4You

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus sterreich Austria mit mehr Service und Support. Hosting ab EUR 450 pro Monat. Domains ab 950 pro Jahr. Webhosting auf Highspeed Servern. Inklusive ...

Tagged as: software, forum, hosting. See more tags (33) at world4you.com page.

http://www.world4you.com/-54-1-1-de--/cms.html

Php.cn Favicon Php.cn

Tagged as: php, kt qu trc tuyn, php. See more tags (13) at php.cn page.

http://php.cn

Melisai.com - Connection Problems

Melisai.Com - Index

Tagged as: forum, php, board. See more tags (14) at melisai.com page.

http://melisai.com/

Pya.cc Favicon Pya.cc - pya!

18

Tagged as: flash, googlereader, musicianswanted. See more tags (14) at pya.cc page.

http://pya.cc/

Unas.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: web, hosting, php. See more tags (14) at unas.cz page.

http://www.webzdarma.cz/

Frihost.com Favicon Frihost.com - Frihost - Free php hosting and free domains

Tagged as: web hosting, internet, web. See more tags (20) at frihost.com page.

http://www.frihost.com/

Simplemachines.org Favicon Simplemachines.org - Simple Machines Forum - Free & open source community software

Simple Machines offers free open source software such as SMF the powerful and easy to use community forum written in PHP. Start interesting discussions on your website!

Tagged as: forum, php, board. See more tags (19) at simplemachines.org page.

http://simplemachines.org/

Dbforums.com Favicon Dbforums.com - dBforums - Database Support Community

dBforums is a discussion forum and helpdesk for database design development and administration issues. To visit the forum go to httpdbforums.com

Tagged as: forum, php, server. See more tags (31) at dbforums.com page.

http://www.dbforums.com/

Phpmydirectory.com Favicon Phpmydirectory.com - phpMyDirectory - Web Portal Business Directory Classifieds Link Indexing

phpMyDirectory is the leading website portal solution. Build and manage a powerful website with ease. Built using PHP and MySQL phpMyDirectory can be used to create websites focused on a business directory classifieds link indexing and more...

Tagged as: php, business directory, e business. See more tags (31) at phpmydirectory.com page.

http://www.phpmydirectory.com/

Sql.ru Favicon Sql.ru - SQL.ru - SQL

SQL - . MSSQL Oracle Interbase MySQL

Tagged as: sql, sql server, oracle. See more tags (23) at sql.ru page.

http://www.sql.ru/

Absba.com Favicon Absba.com

Tagged as: blog, games, windows. See more tags (33) at absba.com page.

http://absba.com/

Muslmh.com Favicon Muslmh.com

Tagged as: blog, games, game. See more tags (32) at muslmh.com page.

http://muslmh.com/

Mybboard.net Favicon Mybboard.net - MyBB

The official homepage for MyBB a free PHP and MySQL based discussion system

Tagged as: software, forum, php. See more tags (19) at mybboard.net page.

http://www.mybb.com/

Kohanaphp.com Favicon Kohanaphp.com - Kohana The Swift PHP Framework

Kohana homepage. Kohana is an HMVC PHP5 framework that provides a rich set of components for building web applications

Tagged as: events, easy to use, forums. See more tags (29) at kohanaphp.com page.

http://kohanaframework.org/

Lix.jp Favicon Lix.jp - lix.jp - lix.jp

JSN lix.jp - lix.jp

Tagged as: blog, php, cgi. See more tags (21) at lix.jp page.

http://lix.jp

Mabinogiworld.com Favicon Mabinogiworld.com - Mabinogi World

Welcome to Mabinogi World! We are a fansite with a friendly community. First established in December 2007

Tagged as: forum, php, board. See more tags (16) at mabinogiworld.com page.

http://mabinogiworld.com/

Lakuma2.com Favicon Lakuma2.com - Lakuma2.com

Find Akuma Internet Services and more at Lakuma2.com. Get the best of Phone For All Internet Service or Sprint Internet Service browse our section on Internet Service Provider or learn about My Verizon.Com. Lakuma2.com is the site for Akuma

Tagged as: forum, php, board. See more tags (17) at lakuma2.com page.

http://lakuma2.com/

Ovh.de Favicon Ovh.de - Hosting und Internetlsungen - OVH

Das Unternehmen OVH stellt sich vor! Erfahren Sie Wissenswertes ber den europischen Marktfhrer fr Internet-Hosting das OVH Netzwerk und die Rechenzentren

Tagged as: php, linux, perl. See more tags (26) at ovh.de page.

http://www.ovh.de/

Galacsys.net Favicon Galacsys.net - GalacSYS

GalacSYS est un hbergeur de messagerie et serveur web

Tagged as: php, perl, oktan semeli. See more tags (20) at galacsys.net page.

http://www.galacsys.net/

Webmasterforums.com Favicon Webmasterforums.com - Webmaster Forums - Webmaster forum for HTML PHP ASP CSS and more

Webmaster forums offers help and resources in web development website design web hosting search engine marketing HTML XML Perl Java JavaScriptxhtml CSS PHP mySQL SEO and web design

Tagged as: webdesign, web hosting, seo. See more tags (24) at webmasterforums.com page.

http://www.webmasterforums.com/

Linuxidc.com Favicon Linuxidc.com - Linux - Linux

Linuxwww.linuxidc.comLinuxLinuxLinuxUbuntuFedoraRedHatLinuxLinuxLinuxSUSE LinuxAndroidOracleHadoop

Tagged as: php, linux, sql. See more tags (18) at linuxidc.com page.

http://www.linuxidc.com/

Sphinxsearch.com Favicon Sphinxsearch.com - Sphinx Open Source Search Server

Tagged as: search engine, open source, sql. See more tags (20) at sphinxsearch.com page.

http://sphinxsearch.com/

Websitebaker2.org Favicon Websitebaker2.org - WebsiteBaker CMS Open Source Content Management

WebsiteBaker helps you to create the website you want A free easy secure flexible and extensible Open Source Content Management System

Tagged as: management system, php, content management system. See more tags (16) at websitebaker2.org page.

http://www.websitebaker.org/en/home.php

Searches related to: mysql

What people search with mysql:

more...