SmartViper

Php websites probably the best selection from 24,773 total domains

Visitors who searched Php also search mysql,  html,  web

Funclub-brasil.com - Welcome!

Tagged as: management system, content management system, fun club. See more tags (5) at funclub-brasil.com page.

http://m.thumbr.com/

Insite.com.br Favicon Insite.com.br - Insite Solues Internet Bot de Inteligncia Artificial Salas de Chat Servio de webmail e Mailing e-mail marketing Fruns de discusso e desenvolvimento de software

Insite Solues Internet - Solues inteligentes para websites - Bot de Inteligncia Artificial utilidades para web como servio de webmail e servio de mailing ou e-mail marketing Fruns de discusso e desenvolvimento de software

Tagged as: windows, linux, email. See more tags (30) at insite.com.br page.

http://insite.com.br/

50webs.com Favicon 50webs.com - Free Web Hosting Affordable Shared Hosting and Domain Names by 50Webs

50Webs is a leading provider of free web hosting low-cost shared hosting and domain names. 500000 websites trust 50Webs for their hosting needs

Tagged as: web hosting, web, hosting. See more tags (32) at 50webs.com page.

http://www.50webs.com/

Phpnuke.org Favicon Phpnuke.org - PHP-Nuke

Content management and portal solution featuring web-based administration surveys customizable blocks modules and themes with multilanguage support. Php news and free downloads

Tagged as: blog, news, forum. See more tags (28) at phpnuke.org page.

http://www.phpnuke.org/

Elance.com Favicon Elance.com - Hire freelancers and find freelance jobs instantly Elance

Access over 2 million skilled freelancers from around the world. Find rated web developers mobile programmers designers writers translators marketing pros virtual assistants and more

Tagged as: seo, joomla, flash. See more tags (28) at elance.com page.

http://elance.com/

Wz.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: web, hosting, mysql. See more tags (9) at wz.cz page.

http://www.webzdarma.cz/

Phpbuilder.com Favicon Phpbuilder.com - PHP Developers Sharing Knowledge Since 1999 PHPBuilder.com

PHP Developers Sharing Knowledge Since 1999

Tagged as: e commerce, flash, mysql. See more tags (31) at phpbuilder.com page.

http://www.phpbuilder.com/

Ic.cz Favicon Ic.cz - IC.cz - webhosting zdarma freehosting PHP4 PHP5 MySql PostgreSql strnky zdarma blog fotogalerie

Free web host and web tool provider. Get a website guestbook counter etc. We support php php5 mysqlpostgresql technologies.!

Tagged as: a website, web, hosting. See more tags (27) at ic.cz page.

http://www.ic.cz/

Online.fr Favicon Online.fr - Accueil - Online.net

Hbergement mutualis trafic illimit nom de domaine et serveur ddi Dedibox

Tagged as: en ligne, boutique en ligne, nom de domaine. See more tags (12) at online.fr page.

http://www.online.net/fr

Bplaced.net Favicon Bplaced.net - bplaced - Webspace & Webhosting 2GB Freehost The place for your webspace

Tagged as: hosting, mysql, webhosting. See more tags (12) at bplaced.net page.

http://www.bplaced.net/

Vn-zoom.com Favicon Vn-zoom.com - VN-Zoom - Chia s kin thc v phn mm my tnh

Softwares - Entertainment - Games

Tagged as: web hosting, video, games. See more tags (33) at vn-zoom.com page.

http://www.vn-zoom.com/

Atpages.jp Favicon Atpages.jp - @PAGES!!

PAGES 1GBPHPCGI

Tagged as: mysql, cgi, iletim. See more tags (10) at atpages.jp page.

http://atpages.jp/

Knowsky.com Favicon Knowsky.com - www.knowsky.com

jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop

Tagged as: mysql, linux, server. See more tags (25) at knowsky.com page.

http://knowsky.com/

Webadictos.com.mx Favicon Webadictos.com.mx - WebAdictos

Tagged as: internet, mysql, javascript. See more tags (19) at webadictos.com.mx page.

http://www.webadictos.com.mx/

Hotscripts.com Favicon Hotscripts.com - Hot Scripts - The net's largest PHP CGI Perl JavaScript and ASP script collection and resource web portal

Hot Scripts is the net's largest PHP CGI Perl JavaScript and ASP script collection and resource web portal. We are an Internet directory that compiles and distributes Web programming-related resources geared toward webmasters developers and...

Tagged as: web development, java, programming. See more tags (22) at hotscripts.com page.

http://www.hotscripts.com/

Siteduzero.com Favicon Siteduzero.com - OpenClassrooms ex-Le Site du Zro - Les cours les plus ouverts du Web

Tagged as: design, web, mysql. See more tags (30) at siteduzero.com page.

http://fr.openclassrooms.com/

Locaweb.com.br Favicon Locaweb.com.br - Hospedagem de Sites com Domnio Grtis - Conhea Nossos Produtos - Locaweb

Hospedagem de sites solues de infraestrutura para sua empresa na Internet. Hospedagem de sites em ambiente compartilhado. Hospedagem de sites em servidores dedicados. Hospedagem de lojas virtuais. Hospedagem de solues dedicadas. Hospedagem ...

Tagged as: ecommerce, email, java. See more tags (30) at locaweb.com.br page.

http://www.locaweb.com.br/default.html

Bigresource.com Favicon Bigresource.com - BigResource Webmaster Scripts & Tutorials Directory

Over 38000 indexed Scripts and Tutorials for webmasters. Resource center for PHP CGI FLASH XML ASP ASP.NET Phython and CFMLscripts

Tagged as: e commerce, asp, asp net. See more tags (22) at bigresource.com page.

http://bigresource.com/

68design.net Favicon 68design.net

Tagged as: flash, photoshop, asp. See more tags (24) at 68design.net page.

http://68design.net/

Pandora.nu - PANDORA

2

Tagged as: sql, cgi, ssl. See more tags (18) at pandora.nu page.

http://pandora.nu/

Webd.pl - Tani Profesjonalny Hosting WWW Serwery i Domeny od 399 PLN

Profesjonalne usugi hostingowe dla firm oraz uytkownikw indywidualnych. Serwery PHP MySQL. Rejestracja domen krajowych regionalnych oraz midzynarodowych

Tagged as: hosting, mysql, www. See more tags (26) at webd.pl page.

http://webd.pl/

Codes-sources.com Favicon Codes-sources.com - CodeS-SourceS - CCM

Le rseau CodeS-SourceS est une communaut de dveloppeurs francophones de tout bord et de toute culture informatique. Cette communaut regroupe plus de 1 400 000 membres avril 2009 travers une ide simple partager ses connaissances. Plus de 5...

Tagged as: flash, java, javascript. See more tags (34) at codes-sources.com page.

http://codes-sources.commentcamarche.net/#./?&_suid=1383814383263077595258991...

Codingforums.com Favicon Codingforums.com - CodingForums.com- Web coding and development forums. Get help on JavaScript PHP CSS XML mySQL ASP and more!

Web coding and development forums. Get help on JavaScript PHP CGI CSS XML and more

Tagged as: for sale, css, database. See more tags (18) at codingforums.com page.

http://www.codingforums.com/

Pytal.de Favicon Pytal.de - Pytal

Tagged as: community, mysql, gratis. See more tags (13) at pytal.de page.

http://www.pytal.de/

Tranungkite.net - TranungKite Online TKO

Berita Terkini Pelbagai Sumber

Tagged as: blog, forum, games. See more tags (36) at tranungkite.net page.

http://tranungkite.net/v12/

Zenon.net Favicon Zenon.net - " ..."

Tagged as: hosting, mysql, windows. See more tags (36) at zenon.net page.

http://www.zenon.net/

Photography-on-the.net Favicon Photography-on-the.net - Digital camera photo galleries gallery database info and forums

Digital photo gallery database with camera and lens search. Canon digital camera photo forum Exhibit Engine PHP photo gallery program

Tagged as: music, forum, photo gallery. See more tags (36) at photography-on-the.net page.

http://photography-on-the.net/

Nakuz.com Favicon Nakuz.com - Nakuz - Powered by Discuz!

Nakuz Nakuz.com - Web GameAPPS - Discuz! Board

Tagged as: online, forum, flash. See more tags (18) at nakuz.com page.

http://nakuz.com/

Digitalz.org - Digitalz.org - ndice

Digitalz.org - ndice

Tagged as: forum, mysql, board. See more tags (13) at digitalz.org page.

http://www.digitalz.org/foro/

80code.com - 80code.com

4806GBOKMySQLSSL

Tagged as: mysql, net, cgi. See more tags (35) at 80code.com page.

http://80code.com/

Supportnet.de Favicon Supportnet.de - Supportnet - Ratgeber Forum fr Computer und Internet

Supportnet Computerprobleme Forum Tipps & Tricks News Hilfe Suche Chat Vista Windows XP 2000 NT ME 98 95 Linux Textverarbeitung Tabellenkalkulation Datenbank Bildbearbeitung Outlook mp3 Viren Internet Office Mainboard Grafikkarte DSL ISD...

Tagged as: internet, news, forum. See more tags (37) at supportnet.de page.

http://www.supportnet.de/

Msfn.org Favicon Msfn.org - News - MSFN - Frontpage

Tagged as: internet, software, games. See more tags (35) at msfn.org page.

http://www.msfn.org/

Planet-source-code.com Favicon Planet-source-code.com - Planet Source Code home page

Tagged as: database, java, asp. See more tags (34) at planet-source-code.com page.

http://planet-source-code.com/

Ntnu.edu.tw Favicon Ntnu.edu.tw

XOOPS is a dynamic Object Oriented based open source portal script written in PHP

Tagged as: cms, mysql, portal. See more tags (37) at ntnu.edu.tw page.

http://www2.ntnu.edu.tw/

Paste2.org Favicon Paste2.org - Paste2.org - New Paste

Pastebin style awesomeness - collaborative developing and debugging

Tagged as: javascript, perl, ruby. See more tags (12) at paste2.org page.

http://paste2.org/

Dreamhost.com Favicon Dreamhost.com - Web Hosting Domains VPS Dedicated and WordPress Hosting - DreamHost

DreamHost is the leader in shared web hosting vps hosting dedicated hosting WordPress hosting cloud storage and cloud computing. Try us for Free today

Tagged as: web hosting, ecommerce, mysql. See more tags (35) at dreamhost.com page.

http://www.dreamhost.com/

World4you.com Favicon World4you.com - Webspace Webhosting Domain World4You

Webspace und Webhosting sowie Domain Rootserver und Domainregistrierungen. Ihr Provider aus sterreich Austria mit mehr Service und Support. Hosting ab EUR 450 pro Monat. Domains ab 950 pro Jahr. Webhosting auf Highspeed Servern. Inklusive ...

Tagged as: software, forum, hosting. See more tags (34) at world4you.com page.

http://www.world4you.com/-54-1-1-de--/cms.html

Php.cn Favicon Php.cn

Tagged as: mysql, revista eletrnica, kt qu trc tuyn. See more tags (15) at php.cn page.

http://php.cn

Easycgi.com Favicon Easycgi.com - EasyCGI

Affordable Windows Web Hosting Service Provider offering ASP ASP.net 2.0 Windows 2003 and 2008 Hosting Environment with Reseller Hosting Available. Low cost business hosting services - Easy CGI

Tagged as: web hosting, a website, service provider. See more tags (31) at easycgi.com page.

http://www.easycgi.com/

Online.net Favicon Online.net - Accueil - Online.net

Hbergement mutualis trafic illimit nom de domaine et serveur ddi Dedibox

Tagged as: en ligne, boutique en ligne, nom de domaine. See more tags (19) at online.net page.

http://www.online.net/fr

Melisai.com - Connection Problems

Melisai.Com - Index

Tagged as: forum, mysql, board. See more tags (15) at melisai.com page.

http://melisai.com/

Hardwaremania.com Favicon Hardwaremania.com - hARDWAREMANIA - Gvenilir Donanm ve Teknoloji Rehberiniz

Tagged as: email, html, chat. See more tags (33) at hardwaremania.com page.

http://www.hardwaremania.com/

Unas.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: web, hosting, mysql. See more tags (14) at unas.cz page.

http://www.webzdarma.cz/

Frihost.com Favicon Frihost.com - Frihost - Free php hosting and free domains

Tagged as: web hosting, internet, web. See more tags (20) at frihost.com page.

http://www.frihost.com/

Simplemachines.org Favicon Simplemachines.org - Simple Machines Forum - Free & open source community software

Simple Machines offers free open source software such as SMF the powerful and easy to use community forum written in PHP. Start interesting discussions on your website!

Tagged as: forum, mysql, board. See more tags (19) at simplemachines.org page.

http://simplemachines.org/

Dbforums.com Favicon Dbforums.com - dBforums - Database Support Community

dBforums is a discussion forum and helpdesk for database design development and administration issues. To visit the forum go to httpdbforums.com

Tagged as: forum, mysql, server. See more tags (31) at dbforums.com page.

http://www.dbforums.com/

Go4expert.com Favicon Go4expert.com - Programming and Web Development Forum

Go4Expert is a community of tech professionals. Forum provides free help advice and opinions to your questions coupled with a vast variety of tutorials and articles

Tagged as: seo, graphics, java. See more tags (21) at go4expert.com page.

http://www.go4expert.com/

Searches related to: php

What people search with php:

more...