SmartViper

musclecarclub.com

Musclecarclub.com - American Muscle Car information statistics and pictu...

edit
The home of the Muscle Car Club featuring information statistics and pictures of American Muscle Cars



Rating:
4 of 5 (2 votes)
Indexed pages:
68,073 (754)
Backwards:
10,952 (312)
Links from homepages:
16 links (from 4 hosts)
updated November 6, 2013
Homepage links:
internal 241, external 86
Unique visitors:
253 ( 82)
diff as of July 1, 2013
Snapshot history:
8 available via snapshot tool
HTML validation:
Error
DNS resolve:
OK
Domain worth:
$173,301
Health score:
53.96%

Technical

Website availability: (is site down?)
Used technologies:
Analytics
Google Analytics
Operating systems
UNIX
Web server extensions
mod_ssl (version 2.2.26)
OpenSSL (version 1.0.1e)
Web servers
Apache (version 2.2.26)
Hosting:
Infinitum Technologies (Infinitum Technologies Inc.)
Hosting abuse phone:
office +1-407-442-2896
Hosting abuse mail:
Domain IP:
66.35.67.66 United States (1 changes since July 7, 2009)
IP history:
July 7, 2009 216.36.247.54 (Hostway Corporation) → 66.35.67.66(Infinitum Technologies)
DNS Resolve:
OK
Domain registrar:
GODADDY.COM, LLC domain profile
Domains using same registrar:1,364,460
Name server (NS) records:
ns6766.rapidvps.net (IP 66.35.67.66)
Other domains using this NS: (4): classicmusclecars.com, trailconditions.com, modernmusclecars.net, procarinsuranceagents.com
ns6767.rapidvps.net (IP 66.35.67.67)
Other domains using this NS: (4): classicmusclecars.com, trailconditions.com, modernmusclecars.net, procarinsuranceagents.com
NS history:
1 changes since July 7, 2009
July 7, 2009 a.dns.hostway.net
b.dns.hostway.net
ns6766.rapidvps.net
ns6767.rapidvps.net
Public registrar record:

Profile

Unique visitors:
253 ( 82)
diff as of July 1, 2013
Domain age:
20 years and 2 months
Domain worth:
$173,301
Health score:
53.96%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #musclecarclub.com

Social activity: updated 15 Jul 2014
Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
muscle car (14%, $0.94), muscle (11%, $1.20), car club (11%, $1.82), car (10%, $5.36), car information (8%, $3.81)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    68,073 (754)
    Backwards:
    10,952 (312)
    Homepage links:
    internal 241, external 86
    HTML validation:
    Error
    Title:
    Musclecarclub.com - American Muscle Car information statistics and pictures
    Meta-keywords:
    musclecarclubamericanmusclecarsautomobilesvehicles amcbuickchevroletchryslerdodgefordpontiacplymoutholdsmobile amxjavelingsrivieraskylarkwildcatcamarochevellecorvetteimpalamontecarlo nova300challengerchargercoronetdartdaytonasuperbeemustangtorino cougar4-4-2roadrunnerfirebirdgtocatalina22409454455
    Meta-description:
    The home of the Muscle Car Club featuring information statistics and pictures of American Muscle Cars
    Links from homepages:(detailed)
    16 links (from 4 unique hosts)
    Examples: modernmusclecars.net, camaro.com, car4ur.com, guzcars.blogspot.com
    Smartviper Domain RSS:
    Get the latest updates on musclecarclub.com via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 1,948 search engine queries. Average position in SERP is 18. Best position in SERP for this domain is #1 (it's found 24 times). Statistical information was collected from April 20, 2012 to April 23, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.