SmartViper

signaturedomains.com

SignatureDomains Domain Name Registration - Register Your Domain Today!

edit
Domain registration and enterprise class domain management



Rating:
4.5 of 5 (4 votes)
Indexed pages:
2 (2)
Backwards:
299 (9)
Links from homepages:
2 links (from 1 hosts)
updated November 6, 2013
Homepage links:
internal 0, external 11
Unique visitors:
260 ( 233)
diff as of July 1, 2010
Snapshot history:
27 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
Errors check details
Duplicates:
Duplicates: with similar meta description: 11, with similar title: 11. Details
DNS resolve:
OK
Domain worth:
$62,472
Health score:
24.30%

Technical

Website availability: (is site down?)

Latest result: Website is UP

Latest test time and date: 1:44:45 AM November 3, 2013

Latest test duration: 2.685 seconds


Test results (detailed CURL answer)
HTML size: 3798 bytes
Url: http://signaturedomains.com
Content_type: text/html
Http_code: 200
Header_size: 171
Request_size: 179
Filetime: -1
Total_time: 2.682915
Namelookup_time: 2.608282
Connect_time: 2.615542
Pretransfer_time: 2.615571
Size_download: 3798
Speed_download: 1415
Download_content_length: 3798
Starttransfer_time: 2.682821
Used technologies:
Programming languages
PHP (version 5.2.17)
Web servers
Apache (version 2)
Hosting:
SAVVIS Communications Corporation (The Endurance International Group, Inc.)
Hosting abuse phone:
office +1-877-659-6181
Hosting abuse mail:
Domain IP:
64.85.73.116 United States
DNS Resolve:
OK
Domain registrar:
DOMAIN.COM, LLC domain profile
Domains using same registrar:64,207
Name server (NS) records:
ns1.signaturedomains.com (IP 66.96.142.146)
Other domains using this NS: (2): tonybennett.com
ns5.signaturedomains.com (IP 66.96.142.147)
Other domains using this NS: (1): tonybennett.com
ns6.signaturedomains.com (IP 65.254.254.171)
Other domains using this NS: (1): tonybennett.com
Public registrar record:

Profile

Unique visitors:
260 ( 233)
diff as of July 1, 2010
Domain age:
20 years and 8 months
Domain worth:
$62,472
Health score:
24.30%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #signaturedomains.com

Social activity: updated 19 Oct 2013
Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
domain (6%, $9.57), domains (6%, $5.83), domainname registration (6%), domain name (5%, $11.57), domain registration (4%, $15.52) (charts and stats)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    2 (2)
    Backwards:
    299 (9)
    Homepage links:
    internal 0, external 11
    Title history:
    1 changes recorded
    HTML validation:
    Errors check details
    Title:
    SignatureDomains Domain Name Registration - Register Your Domain Today!
    Meta-keywords:
    domainregistrationnameregisterwebsearchinternetservicesbuynewtransferregistrarservicecheckavailabilityinformationusnettopleveltvbuyingwholookupnomukregisteringpurchasedomain register domain lookup domain name web hosting web hosting website
    Meta-description:
    Domain registration and enterprise class domain management
    Links from homepages:(detailed)
    2 links (from 1 unique hosts)
    Examples: domain-price-wars.com
    Smartviper Domain RSS:
    Get the latest updates on signaturedomains.com via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 8 search engine queries. Average position in SERP is 31. Best position in SERP for this domain is #13 (it's found 1 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.